Word Lists Word Search

List of 12-letter words containing

Rapid Mode

Click to add a seventh letter

Click to remove a letter

Click to change word size
All alphabeticalAll by size789101112131415161718192021


There are 15 twelve-letter words containing A, I, K, L, M and V

makaluvaminemake␣believesmakes␣a␣livingMarkleevilleMi-Wuk␣Villagepavementlikeshovelmakingsleevemakingvahlkampfiidvanadiumlikeviolinmakers violin␣makersviolinmakingzelkovamycinziltivekimab

15 definitions found

  • makaluvamine — n. (Organic chemistry) Any of a group of cytotoxic pyrroloquinoline alkaloids.
  • make␣believes — n. Plural of make believe.
  • makes␣a␣living — v. Third-person singular simple present indicative form of make a living.
  • Markleeville — prop.n. A census-designated place, the county seat of Alpine County…
  • Mi-Wuk␣Village — prop.n. A census-designated place in Tuolumne County, California, United States.
  • pavementlike — adj. Resembling or characteristic of pavement.
  • shovelmaking — n. The manufacture of shovels.
  • sleevemaking — n. The manufacture of sleeves for garments.
  • vahlkampfiid — n. (Zoology) Any member of the family Vahlkampfiidae of protozoans.
  • vanadiumlike — adj. (Chemistry) Resembling vanadium.
  • violinmakers — n. Plural of violinmaker.
  • violin␣makers — n. Plural of violin maker.
  • violinmaking — n. The construction of violins.
  • zelkovamycin — n. (Medicine) A cyclic peptide antibiotic isolated from a species…
  • ziltivekimab — n. A particular monoclonal antibody.
Previous ListNext List
Random wordBack to top

See this list for:

  • Scrabble in English: 1 word
  • French Wiktionary: 6 words
  • Spanish Wiktionary: no word
  • Italian Wiktionary: no word
  • German Wiktionary: 28 words
  • Portuguese Wiktionary: no word
  • Dutch Wiktionary: 13 words

Recommended websites



Ortograf Inc.This site uses web cookies, click to learn more. Our privacy policy.
© Ortograf Inc. Website updated on 23 June 2023 (v-2.0.1z). Informations & Contacts.