Word Lists Word Search

List of 10-letter words containing

Rapid Mode

Click to add an eighth letter

You have reached the 7-letter limit.

Click to remove a letter

Click to change word size
All alphabeticalAll by size89101112131415161718192021


There are 21 ten-letter words containing A, C, E, I, K, N and Y

agencylikecanarylikecanopylikecanyonlikecity␣bankercrayonlikecreakinglycytokinaseEysenckiangay␣chickenhackneyingkanamycineKarnes␣Citykaryogenickeracyaninkitchenarypandemickypanegyrickpanickedlysnickelwaysnickleway

22 definitions found

  • agencylike — adj. Resembling or characteristic of an agency.
  • canarylike — adj. Resembling a canary or having some aspect of one, such as…
  • canopylike — adj. Resembling or characteristic of a canopy.
  • canyonlike — adj. Resembling or characteristic of a canyon.
  • city␣banker — n. (Britain) A banker, stockbroker or other financial worker in the City. — n. (Britain, rhyming slang, derogatory) A wanker.
  • crayonlike — adj. Resembling or characteristic of a crayon.
  • creakingly — adv. With a creaking sound.
  • cytokinase — n. (Biochemistry) An enzyme that activates cytokine.
  • Eysenckian — adj. Of or relating to Hans Eysenck (1916–1997), psychology professor.
  • gay␣chicken — n. A game in which two people of the same sex move their lips…
  • hackneying — v. Present participle of hackney.
  • kanamycine — n. Alternative form of kanamycin.
  • Karnes␣City — prop.n. A city, the county seat of Karnes County, Texas, United States.
  • karyogenic — adj. Relating to karyogenesis.
  • keracyanin — n. Antirrhinin.
  • kitchenary — adj. Relating to a kitchen; culinary.
  • pandemicky — adj. (Informal) Of, relating to, or affected by a pandemic.
  • panegyrick — n. Obsolete form of panegyric.
  • panickedly — adv. In a panicked manner.
  • snickelway — n. (Yorkshire) A narrow alley between buildings.
  • snickleway — n. Alternative form of snickelway.
Previous ListNext List
Random wordBack to top

See this list for:

  • Scrabble in English: 3 words
  • French Wiktionary: 1 word
  • Spanish Wiktionary: no word
  • Italian Wiktionary: no word
  • German Wiktionary: no word
  • Portuguese Wiktionary: no word
  • Dutch Wiktionary: 1 word

Recommended websites



Ortograf Inc.This site uses web cookies, click to learn more. Our privacy policy.
© Ortograf Inc. Website updated on 23 June 2023 (v-2.0.1z). Informations & Contacts.