Word Lists Word Search

List of 10-letter words containing

Rapid Mode

Click to add an eighth letter

You have reached the 7-letter limit.

Click to remove a letter

Click to change word size
All alphabeticalAll by size9101112131415161718192021


There are 20 ten-letter words containing A, I, L, P, 2R and Y

argyrophilarylphorinlyric␣operamicropylarpairs␣royalparolivaryparty␣girlsperikaryalperiorallyperistylarplaywriterprayerlikeprayer␣millpreciliaryprefrailtyprerailwayprovirallysparringlyspirillaryYulparirra

20 definitions found

  • argyrophil — adj. Synonym of argyrophilic.
  • arylphorin — n. (Biochemistry) A larval storage protein.
  • lyric␣opera — n. A nineteenth-century form of French opera, emphasising melody…
  • micropylar — adj. Of or pertaining to micropyles.
  • pairs␣royal — n. Plural of pair royal.
  • parolivary — adj. Situated near the olivary body.
  • party␣girls — n. Plural of party girl.
  • perikaryal — adj. (Anatomy) Relating to a perikaryon.
  • periorally — adv. In a perioral manner.
  • peristylar — adj. Having the form of a peristyle.
  • playwriter — n. One who writes plays; a playwright.
  • prayerlike — adj. Resembling a prayer.
  • prayer␣mill — n. Prayer wheel.
  • preciliary — adj. Prior to the formation of a cilium.
  • prefrailty — n. Presence of the early signs that may lead to frailty.
  • prerailway — adj. Before the development of a railway, or railways in general.
  • provirally — adv. In a proviral manner.
  • sparringly — adv. As if sparring; in a combative manner.
  • spirillary — adj. Relating to Spirillum species.
  • Yulparirra — prop.n. A Pama-Nyungan Australian Aboriginal language spoken in…
Previous ListNext List
Random wordBack to top

See this list for:

  • Scrabble in English: 3 words
  • French Wiktionary: 7 words
  • Spanish Wiktionary: no word
  • Italian Wiktionary: no word
  • German Wiktionary: 2 words
  • Portuguese Wiktionary: no word
  • Dutch Wiktionary: 1 word

Recommended websites



Ortograf Inc.This site uses web cookies, click to learn more. Our privacy policy.
© Ortograf Inc. Website updated on 23 June 2023 (v-2.0.1z). Informations & Contacts.