Word Lists Word Search

List of 11-letter words containing

Rapid Mode

Click to add an eighth letter

You have reached the 7-letter limit.

Click to remove a letter

Click to change word size
All alphabeticalAll by size89101112131415161718192021


There are 16 eleven-letter words containing A, 2C, 2I and 2P

acidopepticamphicarpiccapnophiliccoprincipalcrapperificepoccipitalhippocalcinhippocampicHippocraticnipple␣cactiPacific␣plumpanspecificpick-and-pickpipacyclinepiperic␣acidpræcipices

16 definitions found

  • acidopeptic — adj. Relating to digestion by acid rather than by enzymes.
  • amphicarpic — adj. (Botany) Producing fruit of two kinds, either in shape or…
  • capnophilic — adj. Thriving in the presence of carbon dioxide.
  • coprincipal — n. One of a group of people who act jointly as principals (in various senses).
  • crapperific — adj. (Slang, mildly vulgar) Extremely awful.
  • epoccipital — n. Any of a group of bones, of no obvious function, that lined…
  • hippocalcin — n. (Biochemistry) A particular calcium-binding protein.
  • hippocampic — adj. Relating to the hippocampus.
  • Hippocratic — adj. Pertaining to Hippocrates.
  • nipple␣cacti — n. Plural of nipple cactus.
  • Pacific␣plum — n. The Sierra plum, Prunus subcordata.
  • panspecific — adj. Relating to all (or a large group of) species.
  • pick-and-pick — adj. Synonym of pick-at-will.
  • pipacycline — n. (Pharmacology) A tetracycline antibiotic.
  • piperic␣acid — n. (Organic chemistry) An acid, derived from piperine, that is…
  • præcipices — n. Plural of præcipice.
Previous ListNext List
Random wordBack to top

See this list for:

  • Scrabble in English: 1 word
  • French Wiktionary: 8 words
  • Spanish Wiktionary: 5 words
  • Italian Wiktionary: 59 words
  • German Wiktionary: no word
  • Portuguese Wiktionary: 3 words
  • Dutch Wiktionary: no word

Recommended websites



Ortograf Inc.This site uses web cookies, click to learn more. Our privacy policy.
© Ortograf Inc. Website updated on 23 June 2023 (v-2.0.1z). Informations & Contacts.