Word Lists Word Search

List of 11-letter words containing

Rapid Mode

Click to add an eighth letter

You have reached the 7-letter limit.

Click to remove a letter

Click to change word size
All alphabeticalAll by size89101112131415161718192021


There are 20 eleven-letter words containing A, 2E, F, N, S and Y

defraymentselfin␣safetyEye␣of␣Sauronfan-serviceyfarnesylatefaynshmekerfeel␣one's␣wayfestinatelyfree-and-easy free␣and␣easyfreemasonry Freemasonryleaf␣monkeysleafy␣greensmonkeyfacespenny␣gaffessafety␣reinsShaneyfeltssulfenylatetelefantasy

25 definitions found

  • defrayments — n. Plural of defrayment.
  • elfin␣safety — n. (Britain, informal, derogatory, humorous) occupational health…
  • Eye␣of␣Sauron — prop.n. (Normally used with definite article) A powerful source…
  • fan-servicey — adj. (Fandom slang) Of, relating to, or characteristic of fan service.
  • farnesylate — v. (Biochemistry) To attach a farnesyl group to a protein.
  • faynshmeker — n. (In Jewish communities) A fussy or picky person; a connoisseur.
  • feel␣one's␣way — v. To proceed by touch rather than sight; to feel around. — v. (Idiomatic) To do by guesswork, erring on the side of caution.
  • festinately — adv. (Obsolete) In a festinate manner; hastily; hurriedly.
  • free-and-easy — adj. Alternative form of free and easy. — n. Alternative form of free and easy.
  • free␣and␣easy — adj. Casual, informal, relaxed, unrestrained. — n. (Historical) A tavern offering informal entertainment from…
  • freemasonry — n. Alternative letter-case form of Freemasonry: the institutions… — n. (Figuratively) Fellowship and sympathy among a number of people. — n. (Figuratively) Strange customs which resemble those of Freemasons.
  • Freemasonry — prop.n. The institutions, precepts, and rites of the Freemasons.
  • leaf␣monkeys — n. Plural of leaf monkey.
  • leafy␣greens — n. Leaf vegetables.
  • monkeyfaces — n. Plural of monkeyface.
  • penny␣gaffes — n. Plural of penny gaffe.
  • safety␣reins — n. Plural of safety rein.
  • Shaneyfelts — prop.n. Plural of Shaneyfelt.
  • sulfenylate — v. To cause, or to undergo sulfenylation.
  • telefantasy — n. A television serial with a fantasy theme.
Previous ListNext List
Random wordBack to top

See this list for:

  • Scrabble in English: 3 words
  • French Wiktionary: 60 words
  • Spanish Wiktionary: 1 word
  • Italian Wiktionary: no word
  • German Wiktionary: 2 words
  • Portuguese Wiktionary: no word
  • Dutch Wiktionary: 4 words

Recommended websites



Ortograf Inc.This site uses web cookies, click to learn more. Our privacy policy.
© Ortograf Inc. Website updated on 23 June 2023 (v-2.0.1z). Informations & Contacts.