Word Lists Word Search

List of 11-letter words containing

Rapid Mode

Click to add an eighth letter

You have reached the 7-letter limit.

Click to remove a letter

Click to change word size
All alphabeticalAll by size89101112131415161718192021


There are 15 eleven-letter words containing A, 2I, L, M, P and V

impassivelyimperativalimperviableimplicativepalivizumabpanvitalism pan-vitalismpashkevilimpedilaviumsprimevalityvampirelikevapaliximabvirioplasmsviroplasmicviroplasmin

16 definitions found

  • impassively — adv. In an impassive manner.
  • imperatival — adj. (Grammar) Of or pertaining to the imperative mood.
  • imperviable — adj. Impervious.
  • implicative — adj. Tending to implicate or to imply; pertaining to implication.
  • palivizumab — n. (Pharmacology) A humanized monoclonal antibody used in the…
  • panvitalism — n. Belief that all things are part of a single living universe. — n. Belief that all things in the universe are alive.
  • pan-vitalism — n. Alternative spelling of panvitalism.
  • pashkevilim — n. Plural of pashkevil.
  • pedilaviums — n. Plural of pedilavium.
  • primevality — n. The quality of being primeval.
  • vampirelike — adj. Resembling or characteristic of a vampire.
  • vapaliximab — n. (Pharmacology) A chimeric monoclonal antibody used as an immunosuppressive…
  • virioplasms — n. Plural of virioplasm.
  • viroplasmic — adj. Relating to a viroplasm.
  • viroplasmin — n. (Biochemistry) A multifunctional viral protein.
Previous ListNext List
Random wordBack to top

See this list for:


Recommended websites



Ortograf Inc.This site uses web cookies, click to learn more. Our privacy policy.
© Ortograf Inc. Website updated on 23 June 2023 (v-2.0.1z). Informations & Contacts.