Word Lists Word Search

List of 12-letter words containing

Rapid Mode

Click to add an eighth letter

You have reached the 7-letter limit.

Click to remove a letter

Click to change word size
All alphabeticalAll by size89101112131415161718192021


There are 24 twelve-letter words containing A, D, F, G, I, N and Y

absurdifyingadsignifyingdairy␣farmingdanaid␣eggflydeacidifyingdeamplifyingdeath-defyingdecalcifyingdemassifyingdetackifyingdiabolifyingdoggy␣fashionDuffy␣antigenfairy␣gardensflying␣dragonflying␣squadsforecaddyingfornyrðislagfungicidallyGolden␣Fridayladysfingersplaying␣fieldrancidifyingreacidifying

29 definitions found

  • absurdifying — v. Present participle of absurdify.
  • adsignifying — v. Present participle of adsignify.
  • dairy␣farming — n. A class of animal husbandry enterprise producing dairy products.
  • danaid␣eggfly — n. A common species of nymphalid butterfly, Hypolimnas misippus…
  • deacidifying — v. Present participle of deacidify.
  • deamplifying — v. Present participle of deamplify.
  • death-defying — adj. Very perilous; involving a lot of danger.
  • decalcifying — v. Present participle of decalcify. — adj. That is used to decalcify.
  • demassifying — v. Present participle of demassify.
  • detackifying — v. Present participle of detackify.
  • diabolifying — v. Present participle of diabolify.
  • doggy␣fashion — adv. Alternative form of doggy style.
  • Duffy␣antigen — n. An antigen located on the surface of red blood cells, encoding…
  • fairy␣gardens — n. Plural of fairy garden.
  • flying␣dragon — n. Draco volans, a gliding lizard endemic to Southeast Asia. — n. Any lizard in the genus Draco. — n. Used other than figuratively or idiomatically: see flying, dragon.
  • flying␣squads — n. Plural of flying squad.
  • forecaddying — v. Present participle of forecaddie.
  • fornyrðislag — n. An Old Norse alliterative verse form used largely in the Poetic…
  • fungicidally — adv. In a fungicidal manner; as a fungicide.
  • Golden␣Friday — n. Good Friday.
  • ladysfingers — n. Plural of ladysfinger.
  • playing␣field — n. A field on which a game, especially a ball game, is played. — n. (Figuratively) Any place or context within which competitive…
  • rancidifying — v. Present participle of rancidify.
  • reacidifying — v. Present participle of reacidify. — adj. That reacidifies.
Previous ListNext List
Random wordBack to top

See this list for:

  • Scrabble in English: 3 words
  • French Wiktionary: 1 word
  • Spanish Wiktionary: no word
  • Italian Wiktionary: no word
  • German Wiktionary: no word
  • Portuguese Wiktionary: no word
  • Dutch Wiktionary: no word

Recommended websites



Ortograf Inc.This site uses web cookies, click to learn more. Our privacy policy.
© Ortograf Inc. Website updated on 23 June 2023 (v-2.0.1z). Informations & Contacts.