Word Lists Word Search

List of 12-letter words containing

Rapid Mode

Click to add an eighth letter

You have reached the 7-letter limit.

Click to remove a letter

Click to change word size
All alphabeticalAll by size89101112131415161718192021


There are 18 twelve-letter words containing A, 2E, H, K, N and Y

alkylphenoneAshton␣Keynesempty␣the␣tankepiphanylikefaynshmekershankey-pankeyheterokaryonhooks␣and␣eyeshyperkinesiahyperlinkageketosynthasekey␣exchangeskidney-shapedmonkey␣hammerMonkey␣Hangerphenylalkanepinky␣cheaterYankee␣cheese

20 definitions found

  • alkylphenone — n. (Organic chemistry) Any alkyl phenone.
  • Ashton␣Keynes — prop.n. A village and civil parish in north Wiltshire, England…
  • empty␣the␣tank — v. (Idiomatic) To make the utmost effort; to contribute to the…
  • epiphanylike — adj. Like an epiphany.
  • faynshmekers — n. Plural of faynshmeker.
  • hankey-pankey — n. Alternative form of hanky-panky.
  • heterokaryon — n. (Biology) A cell having two or more genetically different nuclei.
  • hooks␣and␣eyes — n. Plural of hook and eye.
  • hyperkinesia — n. Hyperkinesis.
  • hyperlinkage — n. Overarching or large-scale linkage. — n. (Rare, Internet) The use of hyperlinks.
  • ketosynthase — n. (Biochemistry) Any enzyme that catalyzes the synthesis of ketones…
  • key␣exchanges — n. Plural of key exchange.
  • kidney-shaped — adj. Having a shape like a kidney, that is, an approximately circular…
  • monkey␣hammer — n. A drop press with a ram, which is raised and allowed to fall freely.
  • Monkey␣Hanger — n. (Teesside, Northumbria, offensive) A person from Hartlepool.
  • phenylalkane — n. (Organic chemistry) Any phenyl derivative of an alkane.
  • pinky␣cheater — n. (Medicine, slang) Synonym of fingercot.
  • Yankee␣cheese — n. (Historical) An early form of cheese made by New Englanders… — n. (Derogatory) Synonym of American cheese (Can we add an example…
Previous ListNext List
Random wordBack to top

See this list for:

  • Scrabble in English: 2 words
  • French Wiktionary: 4 words
  • Spanish Wiktionary: no word
  • Italian Wiktionary: no word
  • German Wiktionary: 7 words
  • Portuguese Wiktionary: no word
  • Dutch Wiktionary: 2 words

Recommended websites



Ortograf Inc.This site uses web cookies, click to learn more. Our privacy policy.
© Ortograf Inc. Website updated on 23 June 2023 (v-2.0.1z). Informations & Contacts.