Word Lists Word Search

List of 13-letter words containing

Rapid Mode

Click to add an eighth letter

You have reached the 7-letter limit.

Click to remove a letter

Click to change word size
All alphabeticalAll by size91112131415161718192021


There are 10 thirteen-letter words containing 2A, D, E, P and 2Y

cryptanalyzedhyperacylatedhyperadvocacyhypoadenylatehypohydraemiapaddywhackeryplanetary␣bodypolyacylamidepolyadenylasepolyadenylate

12 definitions found

  • cryptanalyzed — v. Simple past tense and past participle of cryptanalyze.
  • hyperacylated — adj. (Organic chemistry) Excessively acylated.
  • hyperadvocacy — n. Excessive or zealous advocacy, typically on social media.
  • hypoadenylate — v. To adenylate less than normally.
  • hypohydraemia — n. Alternative form of hypohydremia.
  • paddywhackery — n. A stereotyped portrayal of Irish people as garrulous, unreliable…
  • planetary␣body — n. A planetary object.
  • polyacylamide — n. (Organic chemistry) Any polyamide formed by the polymerisation… — n. Misspelling of polyacrylamide.
  • polyadenylase — n. (Biochemistry) An enzyme that degrades polyadenylate.
  • polyadenylate — n. (Chemistry) Any salt or ester of polyadenylic acid. — v. To form the polyadenylate salt or ester of something (especially…
Previous ListNext List
Random wordBack to top

See this list for:

  • Scrabble in English: no word
  • French Wiktionary: 3 words
  • Spanish Wiktionary: no word
  • Italian Wiktionary: no word
  • German Wiktionary: 1 word
  • Portuguese Wiktionary: no word
  • Dutch Wiktionary: no word

Recommended websites



Ortograf Inc.This site uses web cookies, click to learn more. Our privacy policy.
© Ortograf Inc. Website updated on 23 June 2023 (v-2.0.1z). Informations & Contacts.