Word Lists Word Search

List of 13-letter words containing

Rapid Mode

Click to add an eighth letter

You have reached the 7-letter limit.

Click to remove a letter

Click to change word size
All alphabeticalAll by size9101112131415161718192021


There are 18 thirteen-letter words containing A, E, H, K, L, M and P

amphibianlikechampagnelikeephemeral␣lakehumpback␣whalehyperkalaemiahyperkalaemichyperkalemiashypokalaemiashypoleukaemiaKnight␣TemplarLake␣ChamplainLeckhampsteadmetaphysickalmetenkephalin met-enkephalinparchmentlikepavement␣chalkSkelmanthorpe

20 definitions found

  • amphibianlike — adj. Resembling or characteristic of an amphibian.
  • champagnelike — adj. Resembling or characteristic of champagne.
  • ephemeral␣lake — n. (Geology) A lake that is ephemeral; that is, a lake that is…
  • humpback␣whale — n. A species of baleen whale (Megaptera novaeangliae).
  • hyperkalaemia — n. Alternative spelling of hyperkalemia.
  • hyperkalaemic — adj. Alternative form of hyperkalemic.
  • hyperkalemias — n. Plural of hyperkalemia.
  • hypokalaemias — n. Plural of hypokalaemia.
  • hypoleukaemia — n. Alternative form of hypoleukemia.
  • Knight␣Templar — n. (Historical) A knightly member of the crusader age military… — n. A member of a York rite masonic order.
  • Lake␣Champlain — prop.n. A north-south running lake surrounded by the Champlain…
  • Leckhampstead — prop.n. A small village and civil parish in West Berkshire, Berkshire… — prop.n. A small village and civil parish in Buckinghamshire, England…
  • metaphysickal — adj. Obsolete form of metaphysical.
  • metenkephalin — n. (Biochemistry) An endogenous opioid peptide neurotransmitter…
  • met-enkephalin — n. (Biochemistry) One of a pair of pentapeptides, (Tyr-Gly-Gly-Phe-Met)…
  • parchmentlike — adj. Resembling or characteristic of parchment.
  • pavement␣chalk — n. (UK) Synonym of sidewalk chalk.
  • Skelmanthorpe — prop.n. A large village in Denby Dale parish, Kirklees borough…
Previous ListNext List
Random wordBack to top

See this list for:

  • Scrabble in English: no word
  • French Wiktionary: 6 words
  • Spanish Wiktionary: no word
  • Italian Wiktionary: no word
  • German Wiktionary: 37 words
  • Portuguese Wiktionary: no word
  • Dutch Wiktionary: 8 words

Recommended websites



Ortograf Inc.This site uses web cookies, click to learn more. Our privacy policy.
© Ortograf Inc. Website updated on 23 June 2023 (v-2.0.1z). Informations & Contacts.