Word Lists Word Search

List of 8-letter words containing

Rapid Mode

Click to add an eighth letter

You have reached the 7-letter limit.

Click to remove a letter

Click to change word size
All alphabeticalAll by size89101112131415161718192021


There are 9 eight-letter words containing 2A, C, E, K, P and R

capmakerpackagerpackwarepackyear pack-year pack␣yearrapecake rape␣cakerape␣rack

11 definitions found

  • capmaker — n. A person or company that manufactures caps (the headgear).
  • packager — n. A person who packages. — n. A tool or machine used to package objects. — n. A company that hires writers and produces finished books to…
  • packware — n. Goods carried in a pack, especially those for sale by a peddler.
  • packyear — n. A measure of the cigarettes a person has smoked, equal to a…
  • pack-year — n. (Medicine, smoking) A unit for estimating the number of cigarettes…
  • pack␣year — n. Alternative spelling of pack-year.
  • rapecake — n. Alternative form of rape cake.
  • rape␣cake — n. Residue from rapeseed used for animal feed.
  • rape␣rack — n. (Slang) A device for restraining an animal, in experimentation…
Previous ListNext List
Random wordBack to top

See this list for:

  • Scrabble in English: 2 words
  • French Wiktionary: 1 word
  • Spanish Wiktionary: no word
  • Italian Wiktionary: no word
  • German Wiktionary: no word
  • Portuguese Wiktionary: no word
  • Dutch Wiktionary: no word

Recommended websites



Ortograf Inc.This site uses web cookies, click to learn more. Our privacy policy.
© Ortograf Inc. Website updated on 23 June 2023 (v-2.0.1z). Informations & Contacts.