Word Lists Word Search

List of 12-letter words containing

Rapid Mode

Click to add a seventh letter

Click to remove a letter

Click to change word size
All alphabeticalAll by size789101112131415161718192021


There are 24 twelve-letter words containing D, F, G, I, T and Y

affrightedlydeath-defyingdecertifyingdelightfullydemystifyingdenitrifyingdesertifyingdetackifyingdevitrifyingdisgustfullyDuffy␣antigeneightfold␣wayfarsightedlyflying␣doctorfreightyards freight␣yardsfrightenedlyfruiting␣bodygaudefroyitegenotypifiedhigh␣fidelityidentifyingsstupidifyingtypefounding

26 definitions found

  • affrightedly — adv. (Archaic, poetic) with fright.
  • death-defying — adj. Very perilous; involving a lot of danger.
  • decertifying — v. Present participle of decertify.
  • delightfully — adv. In a delightful manner.
  • demystifying — v. Present participle of demystify.
  • denitrifying — v. Present participle of denitrify.
  • desertifying — v. Present participle of desertify.
  • detackifying — v. Present participle of detackify.
  • devitrifying — v. Present participle of devitrify.
  • disgustfully — adv. (Archaic) In a way that inspires disgust.
  • Duffy␣antigen — n. An antigen located on the surface of red blood cells, encoding…
  • eightfold␣way — prop.n. (Physics) a theory that organizes subatomic particles into octets.
  • farsightedly — adv. In a farsighted manner.
  • flying␣doctor — n. (Especially Australia) A doctor who uses a light aircraft to…
  • freightyards — n. Plural of freightyard.
  • freight␣yards — n. Plural of freight yard.
  • frightenedly — adv. In a frightened manner.
  • fruiting␣body — n. (Mycology) The structure on a fungus which houses the spore-producing organs.
  • gaudefroyite — n. (Mineralogy) A hexagonal-pyramidal black mineral containing…
  • genotypified — v. Simple past tense and past participle of genotypify.
  • high␣fidelity — n. The electronic reproduction of a given sound or image with… — n. A high-quality reproduction of sound. — adj. (Of a sound system) Characterized by minimal distortion.
  • identifyings — n. Plural of identifying.
  • stupidifying — v. Present participle of stupidify.
  • typefounding — n. Traditional printing with physical type.
Previous ListNext List
Random wordBack to top

See this list for:

  • Scrabble in English: 11 words
  • French Wiktionary: 1 word
  • Spanish Wiktionary: no word
  • Italian Wiktionary: no word
  • German Wiktionary: no word
  • Portuguese Wiktionary: no word
  • Dutch Wiktionary: no word

Recommended websites



Ortograf Inc.This site uses web cookies, click to learn more. Our privacy policy.
© Ortograf Inc. Website updated on 23 June 2023 (v-2.0.1z). Informations & Contacts.