Word Lists Word Search

List of 12-letter words containing

Rapid Mode

Click to add a seventh letter

Click to remove a letter

Click to change word size
All alphabeticalAll by size89101112131415161718192021


There are 21 twelve-letter words containing D, F, G, 2N and Y

adsignifyingchondrifyingdefunkifyingdegunkifyingdelignifyingdenitrifyingde-Sunnifyingdezincifyingdonkey␣fringeDuffy␣antigenedifyingnessfecundifyingflying␣dragonfolding␣moneyidentifyingsindemnifyingindignifyingnewfangledlyrancidifyingtypefoundingundignifying

23 definitions found

  • adsignifying — v. Present participle of adsignify.
  • chondrifying — v. Present participle of chondrify.
  • defunkifying — v. Present participle of defunkify.
  • degunkifying — v. Present participle of degunkify.
  • delignifying — v. Present participle of delignify.
  • denitrifying — v. Present participle of denitrify.
  • de-Sunnifying — v. Present participle of de-Sunnify.
  • dezincifying — v. Present participle of dezincify.
  • donkey␣fringe — n. A long fringe of hair, longer on one side and plastered down…
  • Duffy␣antigen — n. An antigen located on the surface of red blood cells, encoding…
  • edifyingness — n. The quality of being edifying.
  • fecundifying — v. Present participle of fecundify.
  • flying␣dragon — n. Draco volans, a gliding lizard endemic to Southeast Asia. — n. Any lizard in the genus Draco. — n. Used other than figuratively or idiomatically: see flying, dragon.
  • folding␣money — n. Paper currency; cash in the form of printed banknotes.
  • identifyings — n. Plural of identifying.
  • indemnifying — v. Present participle of indemnify.
  • indignifying — v. Present participle of indignify.
  • newfangledly — adv. In a newfangled manner.
  • rancidifying — v. Present participle of rancidify.
  • typefounding — n. Traditional printing with physical type.
  • undignifying — adj. Not conferring dignity; undignified; demeaning.
Previous ListNext List
Random wordBack to top

See this list for:

  • Scrabble in English: 8 words
  • French Wiktionary: 1 word
  • Spanish Wiktionary: no word
  • Italian Wiktionary: no word
  • German Wiktionary: 1 word
  • Portuguese Wiktionary: no word
  • Dutch Wiktionary: no word

Recommended websites



Ortograf Inc.This site uses web cookies, click to learn more. Our privacy policy.
© Ortograf Inc. Website updated on 23 June 2023 (v-2.0.1z). Informations & Contacts.