Word Lists Word Search

List of 9-letter words containing

Rapid Mode

Click to add a sixth letter

Click to remove a letter

Click to change word size
All alphabeticalAll by size789101112131415161718192021


There are 19 nine-letter words containing E, I, N and 2Y

belyinglycypemycincysteinyldefyinglydenyinglydiethynylenediynylenvyinglyinuysybelneotypifyobeyinglysaying␣yesSydneyiteSyryenianteeny-tinytylomyineunyieldlyxynisteryyeasaying

21 definitions found

  • belyingly — adv. So as to belie.
  • cypemycin — n. A peptide antibiotic obtained from Streptomyces bacteria.
  • cysteinyl — adj. (Biochemistry) Of, pertaining to, or derived from the amino acid cysteine.
  • defyingly — adv. With defiance.
  • denyingly — adv. In a manner that denies.
  • diethynyl — n. (Organic chemistry, in combination) Two ethynyl groups in a molecule.
  • enediynyl — adj. Relating to an enediyne.
  • envyingly — adv. In an envying manner.
  • inuysybel — adj. Obsolete spelling of invisible.
  • neotypify — v. To designate a neotype.
  • obeyingly — adv. (Rare) obediently.
  • saying␣yes — v. Present participle of say yes.
  • Sydneyite — n. A native or inhabitant of Sydney, Australia. — n. A native or resident of Sydney, Nova Scotia, Canada.
  • Syryenian — prop.n. Alternative form of Zyrian. — n. Alternative form of Zyrian.
  • teeny-tiny — adj. (Childish) Very small; tiny.
  • tylomyine — n. Any rat of the subfamily Tylomyinae.
  • unyieldly — adj. Not yieldly; yielding little or nothing; unproductive; useless.
  • xynistery — n. Alternative spelling of xynisteri.
  • yeasaying — v. Present participle of yeasay.
Previous ListNext List
Random wordBack to top

See this list for:

  • Scrabble in English: 2 words
  • French Wiktionary: 7 words
  • Spanish Wiktionary: no word
  • Italian Wiktionary: no word
  • German Wiktionary: 5 words
  • Portuguese Wiktionary: no word
  • Dutch Wiktionary: 3 words

Recommended websites



Ortograf Inc.This site uses web cookies, click to learn more. Our privacy policy.
© Ortograf Inc. Website updated on 23 June 2023 (v-2.0.1z). Informations & Contacts.