Word Lists Word Search

List of 11-letter words containing

Rapid Mode

Click to add a seventh letter

Click to remove a letter

Click to change word size
All alphabeticalAll by size9101112131415161718192021


There are 17 eleven-letter words containing E, 3I, R and W

British␣winein␣prime␣twiginterwikiedkiwi␣berriesmidwiferiesminireviewsperiwiggingpinion␣wiresWeimarizingwhirlimixedwhirlimixerwhirlimixeswhite␣spiritWierzbickiswillardiinewinterisingwinterizing

18 definitions found

  • British␣wine — n. A drink made in Britain by the fermentation of grape (or other…
  • in␣prime␣twig — phr. (UK, slang, obsolete) In good order and high spirits.
  • interwikied — v. Simple past tense and past participle of interwiki.
  • kiwi␣berries — n. Plural of kiwi berry.
  • midwiferies — n. Plural of midwifery.
  • minireviews — n. Plural of minireview.
  • periwigging — v. Present participle of periwig.
  • pinion␣wires — n. Plural of pinion wire.
  • Weimarizing — v. Present participle of Weimarize.
  • whirlimixed — v. Simple past tense and past participle of whirlimix. — adj. Mixed using a whirlimixer.
  • whirlimixer — n. Synonym of vortex mixer.
  • whirlimixes — v. Third-person singular simple present indicative form of whirlimix.
  • white␣spirit — n. A transparent liquid derived from paraffin, used as a solvent…
  • Wierzbickis — prop.n. Plural of Wierzbicki.
  • willardiine — n. (Biochemistry) The amino acid 3-(uracil-1-yl)-L-alanine.
  • winterising — v. Present participle of winterise.
  • winterizing — v. Present participle of winterize.
Previous ListNext List
Random wordBack to top

See this list for:

  • Scrabble in English: 4 words
  • French Wiktionary: 54 words
  • Spanish Wiktionary: 2 words
  • Italian Wiktionary: no word
  • German Wiktionary: 15 words
  • Portuguese Wiktionary: no word
  • Dutch Wiktionary: 6 words

Recommended websites



Ortograf Inc.This site uses web cookies, click to learn more. Our privacy policy.
© Ortograf Inc. Website updated on 23 June 2023 (v-2.0.1z). Informations & Contacts.