Word Lists Word Search

List of 12-letter words containing

Rapid Mode

Click to add a seventh letter

Click to remove a letter

Click to change word size
All alphabeticalAll by size101112131415161718192021


There are 24 twelve-letter words containing E, F and 4I

bikini␣briefsBritishifiesdefinitizingdesilicifieddisacidifieddisacidifiesfemininitiesfemininizingfilicinosideFilipino␣timefinicalitiesfriabilitiesfusibilitiesidiospecificindefinitiesinfelicitiesinfidelitiesinfinitivelysemiinfinite semi-infiniteto-infinitiveunsilicifiedvivificativezu-infinitive

26 definitions found

  • bikini␣briefs — n. Underpants in a bikini bottom style, having less coverage than…
  • Britishifies — v. Third-person singular simple present indicative form of Britishify.
  • definitizing — v. Present participle of definitize.
  • desilicified — adj. From which impregnated silica has been removed.
  • disacidified — v. Simple past tense and past participle of disacidify.
  • disacidifies — v. Third-person singular simple present indicative form of disacidify.
  • femininities — n. Plural of femininity.
  • femininizing — v. Present participle of femininize.
  • filicinoside — n. A particular steroid glycoside.
  • Filipino␣time — n. (Philippines, sometimes derogatory, slang) A notional system…
  • finicalities — n. Plural of finicality.
  • friabilities — n. Plural of friability.
  • fusibilities — n. Plural of fusibility.
  • idiospecific — adj. (Immunology) Specific to a particular antigen.
  • indefinities — n. Plural of indefinity.
  • infelicities — n. Plural of infelicity.
  • infidelities — n. Plural of infidelity.
  • infinitively — adv. (Grammar) In the infinitive form.
  • semiinfinite — adj. Alternative form of semi-infinite.
  • semi-infinite — adj. (Mathematics, in optimization programming) Involving a finite… — adj. (Ballistics, of a target) Sufficiently thick that the level… — adj. Limited at one end but extending to infinity in the other direction.
  • to-infinitive — n. (Grammar) The English infinitive verb form when introduced…
  • unsilicified — adj. Not silicified.
  • vivificative — adj. Tending to animate or give life; vivifying.
  • zu-infinitive — n. (Grammar) a German infinitive form created by adding or infixing…
Previous ListNext List
Random wordBack to top

See this list for:


Recommended websites



Ortograf Inc.This site uses web cookies, click to learn more. Our privacy policy.
© Ortograf Inc. Website updated on 23 June 2023 (v-2.0.1z). Informations & Contacts.