Word Lists Word Search

List of 8-letter words containing

Rapid Mode

Click to add a seventh letter

Click to remove a letter

Click to change word size
All alphabeticalAll by size6789101112131415161718192021


There are 19 eight-letter words containing E, H, I, P, R and Y

chipperycorypheiephydridgephyringryphitehipsteryhyperfithyperiidHyperionhyperitehypernicperkyishpyrohiespyrrhiteshipperyspherifysyrphinewhimperywhispery

24 definitions found

  • chippery — n. A restaurant that sells chips.
  • coryphei — n. Plural of corypheus.
  • ephydrid — n. (Zoology) Any species of the shore fly family Ephydridae.
  • gephyrin — n. (Biochemistry) A protein associated with synapses.
  • gryphite — n. (Paleontology) A shell of the genus Gryphea.
  • hipstery — adj. (Informal) Characteristic of hipsters.
  • hyperfit — adj. (Informal) Extremely fit; at the absolute peak of athletic ability.
  • hyperiid — n. (Zoology) Any amphipod of the suborder Hyperiidea. — n. (Zoology, less common) Any amphipod of the family Hyperiidae.
  • Hyperion — prop.n. (Greek mythology) A Titan, the son of Gaia and Uranus… — prop.n. (Greek mythology) Helios himself, the incarnation of light and beauty. — prop.n. (Astronomy) One of the moons of Saturn.
  • hyperite — n. (Geology) Synonym of hypersthenite.
  • hypernic — n. The wood of a tropical tree Haematoxylon brasiletto (found…
  • perkyish — adj. Somewhat perky.
  • pyrohies — n. Plural of pyrohy.
  • pyrrhite — n. (Mineralogy) A form of pyrochlore.
  • shippery — n. (Fandom slang) The act or practice of supporting or approving… — adj. (Fandom slang) Related to, characteristic of, or appealing…
  • spherify — v. (Transitive) To make spherical.
  • syrphine — n. Any hoverfly of the tribe Syrphini.
  • whimpery — adj. Resembling a whimper. — adj. Making a whimpering sound.
  • whispery — adj. Producing or resembling a whisper.
Previous ListNext List
Random wordBack to top

See this list for:

  • Scrabble in English: 3 words
  • French Wiktionary: 20 words
  • Spanish Wiktionary: no word
  • Italian Wiktionary: no word
  • German Wiktionary: 3 words
  • Portuguese Wiktionary: no word
  • Dutch Wiktionary: 1 word

Recommended websites



Ortograf Inc.This site uses web cookies, click to learn more. Our privacy policy.
© Ortograf Inc. Website updated on 23 June 2023 (v-2.0.1z). Informations & Contacts.