Word Lists Word Search

List of 8-letter words containing

Rapid Mode

Click to add a seventh letter

Click to remove a letter

Click to change word size
All alphabeticalAll by size89101112131415161718192021


There are 20 eight-letter words containing E, 2I, L, N and Y

dilysinedisilynedivinelyepylisinfelinityfinitelyimelysininciselyinediblyinsidelyintirelyKillineylysidinemyelinicsenilitysilicynesylviinexylidineyielding Yielding

30 definitions found

  • dilysine — n. (Biochemistry, uncountable) The dipeptide composed of two lysine moieties. — n. (Biochemistry, countable) The motif in proteins composed of this dipeptide.
  • disilyne — n. (Chemistry) a molecule containing a silicon atom which forms… — n. (Inorganic chemistry) a silicon analog of alkynes containing… — n. (Inorganic chemistry) a silicon analog of ethyne, Si₂H₂ ( SiH≡SiH ).
  • divinely — adv. In a divine manner.
  • epylisin — n. (Biochemistry) A particular human matrix metalloproteinase.
  • felinity — n. (Uncountable) The state of being feline. — n. (Countable) Any feline characteristic. — n. (Humorous) catkind, all cats collectively (cf. humanity).
  • finitely — adv. In a finite manner.
  • imelysin — n. (Biochemistry) Any of a family of peptides first discovered in a Pseudomonas.
  • incisely — adv. (Botany) In an incised manner.
  • inedibly — adv. To the extent of being inedible.
  • insidely — adv. In an inside or internal manner; internally.
  • intirely — adv. Obsolete spelling of entirely. — adv. Misspelling of entirely.
  • Killiney — prop.n. A suburb and seaside resort in Dún Laoghaire-Rathdown, Ireland.
  • lysidine — n. (Organic chemistry) A nucleoside derived from cytidine.
  • myelinic — adj. Relating to myelin.
  • senility — n. (Chiefly uncountable) Senescence; the bodily and mental deterioration… — n. (Chiefly uncountable) The losing of memory and reason due to senescence. — n. (Countable, archaic) An elderly, senile person.
  • silicyne — n. An allotrope of silicon, consisting of a long chain of silicon…
  • sylviine — adj. (Zoology) Relating to the Sylviinae, a group of warblers.
  • xylidine — n. (Organic chemistry) Any of six isomeric aromatic amines (CH…
  • yielding — v. Present participle of yield. — adj. Docile, or inclined to give way to pressure. — n. A concession.
  • Yielding — prop.n. A surname.
Previous ListNext List
Random wordBack to top

See this list for:

  • Scrabble in English: 9 words
  • French Wiktionary: 5 words
  • Spanish Wiktionary: 1 word
  • Italian Wiktionary: no word
  • German Wiktionary: 3 words
  • Portuguese Wiktionary: no word
  • Dutch Wiktionary: no word

Recommended websites



Ortograf Inc.This site uses web cookies, click to learn more. Our privacy policy.
© Ortograf Inc. Website updated on 23 June 2023 (v-2.0.1z). Informations & Contacts.