Word Lists Word Search

List of 11-letter words containing

Rapid Mode

Click to add an eighth letter

You have reached the 7-letter limit.

Click to remove a letter

Click to change word size
All alphabeticalAll by size9101112131415161718192021


There are 22 eleven-letter words containing 2E, H, 2I, N and Y

chimney␣firechimneylikedephytinisedephytinizeDisneyphileetherifyingHellenicityhemicyaninehemicyoninehi-bye␣friendHieronymitehyalinelikehyperfinitehyperiideanlibytheineslie␣in␣the␣wayninetiethlyninety-eightpie-in-the-sky pie␣in␣the␣skysemihyalineyohimbenine

24 definitions found

  • chimney␣fire — n. The combustion of residue deposits referred to as soot or creosote…
  • chimneylike — adj. Resembling a chimney, especially in shape.
  • dephytinise — v. To remove phytic acid (from a foodstuff ingredient).
  • dephytinize — v. Alternative form of dephytinise.
  • Disneyphile — n. A fan of the Walt Disney Company.
  • etherifying — v. Present participle of etherify.
  • Hellenicity — n. The quality or condition of being Ancient Greek.
  • hemicyanine — n. (Organic chemistry) Any of a class of dyes having two aromatic…
  • hemicyonine — n. A member of the extinct subfamily Hemicyoninae.
  • hi-bye␣friend — n. (Informal, chiefly Hong Kong) A person with whom one has only…
  • Hieronymite — n. A member of any of various mediaeval congregations of hermits…
  • hyalinelike — adj. Resembling or characteristic of hyaline.
  • hyperfinite — adj. (Mathematics) Both finite and approximately finite dimensional.
  • hyperiidean — n. (Zoology) Any amphipod of the suborder Hyperiidea.
  • libytheines — n. Plural of libytheine.
  • lie␣in␣the␣way — v. To be readily available, at hand. — v. To be an obstacle.
  • ninetiethly — adv. In the ninetieth place; ninetieth in a row.
  • ninety-eight — num. The cardinal number immediately following ninety-seven —…
  • pie-in-the-sky — adj. (Idiomatic) Lacking reality and serviceability. — adj. (Idiomatic) Of a dream unlikely to ever come true; impractical…
  • pie␣in␣the␣sky — n. (Idiomatic) A fanciful notion; an unrealistic or ludicrous…
  • semihyaline — adj. Partly hyaline.
  • yohimbenine — n. (Organic chemistry) An isomer of yohimbine (of uncertain composition).
Previous ListNext List
Random wordBack to top

See this list for:

  • Scrabble in English: 2 words
  • French Wiktionary: 30 words
  • Spanish Wiktionary: 1 word
  • Italian Wiktionary: no word
  • German Wiktionary: 3 words
  • Portuguese Wiktionary: no word
  • Dutch Wiktionary: 1 word

Recommended websites



Ortograf Inc.This site uses web cookies, click to learn more. Our privacy policy.
© Ortograf Inc. Website updated on 23 June 2023 (v-2.0.1z). Informations & Contacts.