Word Lists Word Search

List of 12-letter words containing

Rapid Mode

Click to add an eighth letter

You have reached the 7-letter limit.

Click to remove a letter

Click to change word size
All alphabeticalAll by size101112131415161718192021


There are 14 twelve-letter words containing E, 3I, K, L and M

criminal-likeepidemiclikekamaishilitemagicianlikemedicinelikemilitarylikemillikelvins milliKelvinsministerlikemisakinolidepickling␣limescimitarliketitaniumlikeziltivekimab

14 definitions found

  • criminal-like — adj. Like, resembling, or befitting a criminal.
  • epidemiclike — adj. Resembling or characteristic of an epidemic.
  • kamaishilite — n. (Mineralogy) A dimorph of bicchulite; a tetragonal colorless…
  • magicianlike — adj. Like a magician.
  • medicinelike — adj. Resembling medicine or some aspect of it.
  • militarylike — adj. Resembling or characteristic of a military.
  • millikelvins — n. Plural of millikelvin.
  • milliKelvins — n. Plural of milliKelvin.
  • ministerlike — adj. Appropriate for or characteristic of a minister.
  • misakinolide — n. (Organic chemistry) A macrolide lactone related to swinholide.
  • pickling␣lime — n. (Cooking) calcium hydroxide or its solution in water, limewater.
  • scimitarlike — adj. Resembling or characteristic of a scimitar.
  • titaniumlike — adj. (Chemistry) Resembling titanium.
  • ziltivekimab — n. A particular monoclonal antibody.
Previous ListNext List
Random wordBack to top

See this list for:

  • Scrabble in English: no word
  • French Wiktionary: 14 words
  • Spanish Wiktionary: no word
  • Italian Wiktionary: no word
  • German Wiktionary: 11 words
  • Portuguese Wiktionary: 1 word
  • Dutch Wiktionary: 6 words

Recommended websites



Ortograf Inc.This site uses web cookies, click to learn more. Our privacy policy.
© Ortograf Inc. Website updated on 23 June 2023 (v-2.0.1z). Informations & Contacts.