Word Lists Word Search

List of 14-letter words containing

Rapid Mode

Click to add an eighth letter

You have reached the 7-letter limit.

Click to remove a letter

Click to change word size
All alphabeticalAll by size9101112131415161718192021


There are 22 fourteen-letter words containing 3E, L, R and 2Y

arylacetylenesBerkeley␣CountyCayley's␣theoremcybercelebritydelayed␣pubertyeleemosynarilyglyceraldehydeheavyheartedly heavy-heartedlyhyperacetylatehyperadenylatehyperintenselyhypermethylasehypermethylatehypermethylomehypermyelinatehyperneddylatehypertensivelykeyhole␣surgerypyridylbenzeneuneleemosynaryYour␣Excellency

23 definitions found

  • arylacetylenes — n. Plural of arylacetylene.
  • Berkeley␣County — prop.n. One of 46 counties in South Carolina, United States. County… — prop.n. One of 55 counties in West Virginia, United States. County…
  • Cayley's␣theorem — prop.n. (Group theory) The theorem stating that every group G…
  • cybercelebrity — n. A person who is a celebrity through the medium of the Internet.
  • delayed␣puberty — n. (Medicine) Absence of any signs of puberty by a specified age…
  • eleemosynarily — adv. In an eleemosynary manner; out of charity; charitably.
  • glyceraldehyde — n. (Biochemistry) The aldotriose 2,3-dihydroxypropanal formed…
  • heavyheartedly — adv. Alternative form of heavy-heartedly.
  • heavy-heartedly — adv. In a heavy-hearted manner; sadly, morosely.
  • hyperacetylate — v. (Biochemistry) To cause or be subject to hyperacetylation.
  • hyperadenylate — v. To cause, or to undergo hyperadenylation.
  • hyperintensely — adv. In a hyperintense manner.
  • hypermethylase — n. (Biochemistry, genetics) An enzyme that catalyses hypermethylation.
  • hypermethylate — v. (Transitive, intransitive) To cause or undergo hypermethylation.
  • hypermethylome — n. (Genetics) The set of nucleic acid hypermethylation in an organism’s…
  • hypermyelinate — v. To myelinate excessively.
  • hyperneddylate — v. To cause, or to undergo hyperneddylation.
  • hypertensively — adv. In a hypertensive way.
  • keyhole␣surgery — n. (Medicine) Surgery using a fibre-optic laparoscope through…
  • pyridylbenzene — n. (Organic chemistry) Synonym of phenylpyridine.
  • uneleemosynary — adj. Not eleemosynary.
  • Your␣Excellency — pron. (Formal) A title of respect used when addressing heads of…
Previous ListNext List
Random wordBack to top

See this list for:

  • Scrabble in English: 2 words
  • French Wiktionary: 18 words
  • Spanish Wiktionary: no word
  • Italian Wiktionary: no word
  • German Wiktionary: no word
  • Portuguese Wiktionary: no word
  • Dutch Wiktionary: no word

Recommended websites



Ortograf Inc.This site uses web cookies, click to learn more. Our privacy policy.
© Ortograf Inc. Website updated on 23 June 2023 (v-2.0.1z). Informations & Contacts.