Word Lists Word Search

List of 16-letter words containing

Rapid ModeEdit List

Click to add an eighth letter

You have reached the 7-letter limit.

Click to remove a letter

Click to change word size
All alphabeticalAll by size89101112131415161718192021


There are 64 sixteen-letter words containing 2E, 2M, 2R and Y

Ackerman␣syndromeAmerican␣sycamoreamperometricallyantisymmetrisersantisymmetrizersasymmetric␣centreasymmetric␣meterscandy␣thermometercenter␣of␣symmetrycentre␣of␣symmetryCleobury␣Mortimercyberimperialismelectrokymogramselectromyelogramelementary␣matrixERM␣protein␣familyferromolybdenumshemicorporectomyhemorrhoidectomyHoly␣Roman␣EmperorhydrodynamometerhygrothermometerhyperconsumerismhyperimperialismhypermeromorphichypermetamorphichypersymmetricalkannemeyeriiformmacrometeorologyMarston␣Moreteynemass␣spectrometrymaternoembryonicmemory␣cartridgesmemory␣typewriternière's␣syndromemercury␣barometermicrodynamometermicrometeorologymicropolymerizedmicroseismometryOmmaya␣reservoirsorders␣of␣symmetryosteomorphometrypaleothermometryPerry␣Mason␣momentprocedural␣memoryradial␣symmetriesread-only␣memoriesreal␣number␣systemRoemheld␣syndromeroentgenkymogramsilvery␣marmosetssupersymmetricalsupersymmetrizedthermogravimetrythermohydrometerthermohygrometerthermometallurgythermometricallythermophotometrythermopolymerizetreeman␣syndromesvideomorphometryYoung␣symmetrizer

Previous ListNext List
Random wordBack to top

See this list for:

  • Scrabble in English: no word
  • French Wiktionary: 26 words
  • Spanish Wiktionary: no word
  • Italian Wiktionary: no word
  • German Wiktionary: 12 words
  • Portuguese Wiktionary: no word
  • Dutch Wiktionary: 3 words

Recommended websites



Ortograf Inc.This site uses web cookies, click to learn more. Our privacy policy.
© Ortograf Inc. Website updated on 23 June 2023 (v-2.0.1z). Informations & Contacts.