Word Lists Word Search

List of 9-letter words containing

Rapid Mode

Click to add a seventh letter

Click to remove a letter

Click to change word size
All alphabeticalAll by size789101112131415161718192021


There are 14 nine-letter words containing I, K, L, 2N and Y

enkelytinhonkinglykailkennyKing's␣LynnKinnerleykinsmanlyknowinglylickpennymankindlynannylikeno-sky␣lineskyliningsnakinglywinkingly

18 definitions found

  • enkelytin — n. (Biochemistry) An antibacterial peptide produced by adrenal…
  • honkingly — adv. With a honking sound. — adv. (Slang) Greatly, hugely, overwhelmingly.
  • kailkenny — n. A variety of rumbledethumps using cream instead of butter.
  • King's␣Lynn — prop.n. A market town and port in Norfolk, England.
  • Kinnerley — prop.n. A village and civil parish in north-west Shropshire, England…
  • kinsmanly — adj. Characteristic of a kinsman.
  • knowingly — adv. In the manner of one who knows. — adv. With knowledge of all relevant facts.
  • lickpenny — n. (Obsolete) Something that devours or absorbs lots of money;… — n. A miserly person. — adj. (Obsolete) Expensive.
  • mankindly — adj. Pertaining to or characteristic of mankind; humanly, humane.
  • nannylike — adj. Resembling or characteristic of a nanny.
  • no-sky␣line — n. (Architecture) An imaginary line in a room, behind which no…
  • skylining — v. Present participle of skyline.
  • snakingly — adv. (Rare) In a snaking manner; serpentinely.
  • winkingly — adv. In a winking way; with a wink.
Previous ListNext List
Random wordBack to top

See this list for:

  • Scrabble in English: 3 words
  • French Wiktionary: 2 words
  • Spanish Wiktionary: no word
  • Italian Wiktionary: no word
  • German Wiktionary: 1 word
  • Portuguese Wiktionary: no word
  • Dutch Wiktionary: no word

Recommended websites



Ortograf Inc.This site uses web cookies, click to learn more. Our privacy policy.
© Ortograf Inc. Website updated on 23 June 2023 (v-2.0.1z). Informations & Contacts.