Word Lists Word Search

List of 10-letter words containing

Rapid Mode

Click to add an eighth letter

You have reached the 7-letter limit.

Click to remove a letter

Click to change word size
All alphabeticalAll by size89101112131415161718192021


There are 14 ten-letter words containing 2I, L, M, 2N and Y

aminovinylfemininelyimminentlyindolmycinleinamycinlincomycinlincomysinlyncomicinminglinglymyoglianinnominalitypinylaminesymlinkingvinylamine

14 definitions found

  • aminovinyl — n. (Organic chemistry) An amino derivative of a vinyl radical.
  • femininely — adv. In a feminine manner.
  • imminently — adv. In an imminent manner; liable to happen immediately or very soon.
  • indolmycin — n. A particular antibacterial drug.
  • leinamycin — n. (Medicine) A macrolide polyketide, produced by several species…
  • lincomycin — n. (Pharmacology) A lincosamide antibiotic derived from Streptomyces…
  • lincomysin — n. Misspelling of lincomycin.
  • lyncomicin — n. Misspelling of lincomycin.
  • minglingly — adv. So as to mingle.
  • myoglianin — n. (Biochemistry) A protein expressed in the muscles and glia of some flies.
  • nominality — n. The quality or state of being nominal.
  • pinylamine — n. (Organic chemistry) An organic compound with chemical formula…
  • symlinking — v. Present participle of symlink.
  • vinylamine — n. (Organic chemistry) The enamine CH2=CH-NH2, used in the manufacture…
Previous ListNext List
Random wordBack to top

See this list for:

  • Scrabble in English: 5 words
  • French Wiktionary: 1 word
  • Spanish Wiktionary: no word
  • Italian Wiktionary: no word
  • German Wiktionary: no word
  • Portuguese Wiktionary: no word
  • Dutch Wiktionary: no word

Recommended websites



Ortograf Inc.This site uses web cookies, click to learn more. Our privacy policy.
© Ortograf Inc. Website updated on 23 June 2023 (v-2.0.1z). Informations & Contacts.