Word Lists Word Search

List of 17-letter words containing

Rapid Mode

Click to add an eighth letter

You have reached the 7-letter limit.

Click to remove a letter

Click to change word size
All alphabeticalAll by size12131415161718192021


There are 4 seventeen-letter words containing I, L, 2T, V and 2Y

catalytic␣activityhyperreflectivitymethyl␣vinyl␣ketonephytoavailability

5 definitions found

Previous ListNext List
Random wordBack to top

Recommended websites



Ortograf Inc.This site uses web cookies, click to learn more. Our privacy policy.
© Ortograf Inc. Website updated on 23 June 2023 (v-2.0.1z). Informations & Contacts.