Word Lists Word Search

List of 17-letter words containing

Rapid Mode

Click to add a sixth letter

Click to remove a letter

Click to change word size
All alphabeticalAll by size101112131415161718192021


There are 9 seventeen-letter words containing 2T, V and 2Y

benevolent␣tyrannycatalytic␣activityhyperconductivityhyperconnectivityhyperreflectivitymethyl␣vinyl␣ketonephytoavailabilityPretty␣Good␣Privacyquantity␣surveyors

12 definitions found

  • benevolent␣tyranny — n. Government of a benevolent tyrant.
  • catalytic␣activity — n. The increase in rate of a chemical reaction caused by the presence… — n. An amount of catalyst, expressed as the increase of the rate of its reaction.
  • hyperconductivity — n. (Physics) The condition of being hyperconductive.
  • hyperconnectivity — n. (Computing) The state of a network in which the number of nodes… — n. (Pathology) The state of the brain, in schizophrenia or epileptic… — n. Increased connectedness of human beings through social media, etc.
  • hyperreflectivity — n. The quality of being hyperreflective.
  • methyl␣vinyl␣ketone — n. (Organic chemistry) Synonym of butenone.
  • phytoavailability — n. The condition of being phytoavailable.
  • Pretty␣Good␣Privacy — prop.n. (Computing) software that encrypts and decrypts messages…
  • quantity␣surveyors — n. Plural of quantity surveyor.
Previous ListNext List
Random wordBack to top

Recommended websites



Ortograf Inc.This site uses web cookies, click to learn more. Our privacy policy.
© Ortograf Inc. Website updated on 23 June 2023 (v-2.0.1z). Informations & Contacts.