Word Lists Word Search

List of 10-letter words beginning with

Rapid Mode

Click to choose the fourth letter

Click to remove the third letter

Click to change word size
All alphabeticalAll by size34567891011121314151617


There are 12 ten-letter words beginning with GIM

gimballinggimbal␣lockgimbletinggimcrackedgimlet-eyedgimlettinggimme␣a␣fivegimmickerygimmickiergimmickilygimmickinggimsilumab

14 definitions found

  • gimballing — v. Present participle of gimbal.
  • gimbal␣lock — n. The loss of one degree of freedom in the three-dimensional…
  • gimbleting — v. Present participle of gimblet.
  • gimcracked — v. Simple past tense and past participle of gimcrack.
  • gimlet-eyed — adj. Having a squint. — adj. Having eyes which are in constant motion; shifty-eyed. — adj. Having piercing eyes, sharp-sighted.
  • gimletting — v. Present participle of gimlet.
  • gimme␣a␣five — v. (Informal, idiomatic) A request to receive a high five.
  • gimmickery — n. Alternative form of gimmickry.
  • gimmickier — adj. Comparative form of gimmicky: more gimmicky.
  • gimmickily — adv. (Rare) In a gimmicky manner.
  • gimmicking — v. Present participle of gimmick.
  • gimsilumab — n. A human monoclonal antibody under investigation for the treatment…
Previous ListNext List
Random wordBack to top

See this list for:

  • Scrabble in English: 3 words
  • French Wiktionary: 15 words
  • Spanish Wiktionary: 25 words
  • Italian Wiktionary: 1 word
  • German Wiktionary: no word
  • Portuguese Wiktionary: no word
  • Dutch Wiktionary: no word

Recommended websites



Ortograf Inc.This site uses web cookies, click to learn more. Our privacy policy.
© Ortograf Inc. Website updated on 23 June 2023 (v-2.0.1z). Informations & Contacts.