Word Lists Word Search

List of 11-letter words beginning with

Rapid Mode

Click to choose the sixth letter

Click to remove the fifth letter

Click to change word size
All alphabeticalAll by size8910111213141718


There are 11 eleven-letter words beginning with MISCL

misclaimingmisclassifymisclassingmiscleaningmiscleavagemiscleavingmisclickingmisclimbingmisclockingmisclosuresmisclusters

12 definitions found

  • misclaiming — v. Present participle of misclaim.
  • misclassify — v. To classify incorrectly.
  • misclassing — v. Present participle of misclass.
  • miscleaning — v. Present participle of misclean.
  • miscleavage — n. (Biochemistry) Faulty cleavage (of a protein etc).
  • miscleaving — v. Present participle of miscleave.
  • misclicking — v. Present participle of misclick.
  • misclimbing — v. Present participle of misclimb.
  • misclocking — v. Present participle of misclock.
  • misclosures — n. Plural of misclosure.
  • misclusters — v. Third-person singular simple present indicative form of miscluster. — n. Plural of miscluster.
Previous ListNext List
Random wordBack to top

See this list for:

  • Scrabble in English: 3 words
  • French Wiktionary: no word
  • Spanish Wiktionary: no word
  • Italian Wiktionary: no word
  • German Wiktionary: no word
  • Portuguese Wiktionary: no word
  • Dutch Wiktionary: no word

Recommended websites



Ortograf Inc.This site uses web cookies, click to learn more. Our privacy policy.
© Ortograf Inc. Website updated on 23 June 2023 (v-2.0.1z). Informations & Contacts.