Word Lists Word Search

List of words beginning with

Rapid Mode

Click to choose the seventh letter

Click to remove the sixth letter

Click to change word size
All alphabeticalAll by size910111213141516


There are 24 words beginning with PARASP

paraspasticparaspeciesparaspecificparaspecificityparaspeckleparaspecklesparaspermparasphenoidparasphenoidalparasphenoidsparaspinalparaspinallyparaspinousparasplenialparasporalparasporal␣bodiesparasporal␣bodyparasporinparasporinsparasport para-sportparasports para-sportsparaspurrite

25 definitions found

  • paraspastic — adj. Relating to spastic paraplegia.
  • paraspecies — n. A species that gave rise to daughter species without itself becoming extinct.
  • paraspecific — adj. (Medicine) Serving as a remedy against conditions beyond…
  • paraspecificity — n. The quality of being paraspecific.
  • paraspeckle — n. (Cytology) An irregularly shaped compartment of the cell, found…
  • paraspeckles — n. Plural of paraspeckle.
  • parasperm — n. (Zoology) In species that exhibit sperm heteromorphism, infertile sperm.
  • parasphenoid — n. (Anatomy) A bone situated immediately beneath the sphenoid… — adj. Lying under or alongside the sphenoid.
  • parasphenoidal — adj. (Anatomy) Relating to the parasphenoid (bone).
  • parasphenoids — n. Plural of parasphenoid.
  • paraspinal — adj. (Anatomy) adjacent to the spine.
  • paraspinally — adv. In a paraspinal manner.
  • paraspinous — adj. Synonym of paraspinal.
  • parasplenial — adj. (Anatomy) Across or beyond the splenium.
  • parasporal — adj. (Biochemistry) Describing a crystalline protein that forms…
  • parasporal␣bodies — n. Plural of parasporal body.
  • parasporal␣body — n. (Biology) A crystalline structure, within the core of an endospore…
  • parasporin — n. Any of a group of proteins with anticancer activity, derived…
  • parasporins — n. Plural of parasporin.
  • parasport — n. (Countable, sports) disabled sport.
  • para-sport — n. Alternative form of parasport.
  • parasports — n. Plural of parasport.
  • para-sports — n. Plural of para-sport.
  • paraspurrite — n. (Mineralogy) A polysynthetically twinned spurrite.
Previous ListNext List
Random wordBack to top

See this list for:

  • Scrabble in English: 2 words
  • French Wiktionary: 6 words
  • Spanish Wiktionary: no word
  • Italian Wiktionary: no word
  • German Wiktionary: 8 words
  • Portuguese Wiktionary: no word
  • Dutch Wiktionary: 1 word

Recommended websites



Ortograf Inc.This site uses web cookies, click to learn more. Our privacy policy.
© Ortograf Inc. Website updated on 23 June 2023 (v-2.0.1z). Informations & Contacts.