Word Lists Word Search

List of 13-letter words ending with

Rapid Mode

Click to choose the fifth to last letter

Click to remove the fifth to last letter

Click to change word size
All alphabeticalAll by size5678910111213141516


There are 12 thirteen-letter words ending with ALIN

allodigitalinaminotetralincinobufotalindifelikefalinhaemaphysalinleuenkephalinmetencephalinmetenkephalin met-enkephalinmicrocephalinpendimethalinproenkephalin

12 definitions found

  • allodigitalin — n. A particular steroid glycoside.
  • aminotetralin — n. Any of a class of stimulant drugs consisting of a tetralin…
  • cinobufotalin — n. (Organic chemistry) A bufadienolide present in toad venom and…
  • difelikefalin — n. An analgesic opioid peptide used to treat itching.
  • haemaphysalin — n. A kallikrein-kinin inhibitor isolated from a tick of the genus Haemaphysalis.
  • leuenkephalin — n. (Biochemistry) An endogenous opioid peptide neurotransmitter…
  • metencephalin — n. Alternative form of metenkephalin.
  • metenkephalin — n. (Biochemistry) An endogenous opioid peptide neurotransmitter…
  • met-enkephalin — n. (Biochemistry) One of a pair of pentapeptides, (Tyr-Gly-Gly-Phe-Met)…
  • microcephalin — n. (Genetics, biochemistry) A protein and associated gene responsible…
  • pendimethalin — n. The herbicide 3,4-dimethyl-2,6-dinitro-N-pentan-3-yl-aniline.
  • proenkephalin — n. (Biochemistry) A precursor of leuenkephalin and metenkephalin.
Previous ListNext List
Random wordBack to top

See this list for:

  • Scrabble in English: no word
  • French Wiktionary: 3 words
  • Spanish Wiktionary: no word
  • Italian Wiktionary: no word
  • German Wiktionary: 1 word
  • Portuguese Wiktionary: no word
  • Dutch Wiktionary: no word

Recommended websites



Ortograf Inc.This site uses web cookies, click to learn more. Our privacy policy.
© Ortograf Inc. Website updated on 23 June 2023 (v-2.0.1z). Informations & Contacts.