Word Lists Word Search

List of words ending with

Rapid Mode

Click to choose the eighth to last letter

Click to remove the eighth to last letter

Click to change word size
All alphabeticalAll by size9101112


There are 11 words ending with DAMYCIN

clindamycinfeldamycinhedamycinlavendamycinlidamycinmeridamycinmirandamycinpacidamycintirandamycinurdamycinvalidamycin

11 definitions found

  • clindamycin — n. (Pharmacology) A lincosamide antibiotic drug C18H33ClN2O5S…
  • feldamycin — n. (Organic chemistry) The antibacterial agent 2S,3R)-3-[[(1S)-1-carboxy-2-(1H-im…
  • hedamycin — n. (Organic chemistry) An antitumor antibiotic 10-[4-(dimethylamino)-5-hydroxy-4…
  • lavendamycin — n. (Organic chemistry) A polycyclic heterocycle present in some soil bacteria.
  • lidamycin — n. An enediyne antitumor antibiotic.
  • meridamycin — n. (Organic chemistry) A macrolide present in Streptomyces hygroscopicus.
  • mirandamycin — n. (Organic chemistry) The phenolic compound 2-(hydroxymethyl)-3-propylbenzene-1…
  • pacidamycin — n. (Medicine) Any of a group of uridyl peptide antibiotics.
  • tirandamycin — n. (Organic chemistry) Any of a group of natural products that…
  • urdamycin — n. (Organic chemistry) Any of a group of angucycline antibiotics…
  • validamycin — n. An antibiotic and fungicide produced by Streptomyces hygroscopicus…
Previous ListNext List
Random wordBack to top

See this list for:

  • Scrabble in English: 1 word
  • French Wiktionary: no word
  • Spanish Wiktionary: no word
  • Italian Wiktionary: no word
  • German Wiktionary: no word
  • Portuguese Wiktionary: no word
  • Dutch Wiktionary: no word

Recommended websites



Ortograf Inc.This site uses web cookies, click to learn more. Our privacy policy.
© Ortograf Inc. Website updated on 23 June 2023 (v-2.0.1z). Informations & Contacts.