Word Lists Word Search

List of 9-letter words ending with

Rapid Mode

Click to choose the sixth to last letter

Click to remove the sixth to last letter

Click to change word size
All alphabeticalAll by size5789101112131415162021


There are 20 nine-letter words ending with SHIFT

backshiftbandshiftblueshiftdownshiftforeshiftgearshift gear␣shiftLamb␣shiftleft␣shiftloanshiftmade␣shiftmakeshift make-shift make␣shiftmass␣shiftovershiftrankshifttilt-shifttimeshiftwork␣shift

39 definitions found

  • backshift — n. (Grammar) The changing of the tense of a verb from present… — n. (Statistics) A function on a stochastic process whose value… — v. (Grammar, transitive) To change the tense of a verb from present…
  • bandshift — n. The movement of a band during electrophoresis or spectroscopy.
  • blueshift — n. (Physics) A change in the wavelength of light, in which the…
  • downshift — n. A change of direction or a movement downwards. — n. A reduction in quality or quantity. — n. A change in career or lifestyle to one which is not as well…
  • foreshift — n. An early shift, or one which precedes another.
  • gearshift — n. Alternative spelling of gear shift. — v. (Rare) To shift gears.
  • gear␣shift — n. (Automotive) That part of a gearbox involved in changing gear… — n. (Automotive, US, Canada) The lever or other interface a human…
  • Lamb␣shift — n. (Quantum mechanics, quantum electrodynamics) A small difference…
  • left␣shift — n. (Computing) A bit shift to the left, in which all of the bits… — n. (Computing) The left shift operator; often given as << or <<<. — v. (Computing) To perform a left shift bitwise operation.
  • loanshift — n. The situation in which a word changes or extends its meaning… — n. A word whose meaning has changed in this way.
  • made␣shift — v. Simple past tense and past participle of make shift.
  • makeshift — n. A temporary (usually insubstantial) substitution. — adj. Made to work or suffice; improvised; substituted. — n. (Obsolete) A rogue; a shifty person.
  • make-shift — adj. Alternative form of makeshift. — n. Alternative form of makeshift.
  • make␣shift — v. (Dated) To contrive; to invent a way of surmounting a difficulty. — adj. Alternative form of makeshift. — n. Alternative form of makeshift.
  • mass␣shift — n. (Physics) The portion of an isotope shift produced by the changing…
  • overshift — n. (Sports) The strategy or act of positioning defensive players… — n. (Mineralogy) The amount of displacement in the layers in a… — n. (Mechanical engineering) A misalignment resulting from shifting…
  • rankshift — v. (Linguistics) To use a phrase as a subunit of a longer one. — n. The action of rankshifting.
  • tilt-shift — n. (Photography, chiefly attributive) The use of camera movements… — n. (Graphical user interface) The blurring of parts of a photograph…
  • timeshift — n. (Plays, films etc.) A change from one time period to another. — v. To retransmit the programmes of a TV channel at a different time of day.
  • work␣shift — n. A shift (change of workers).
Previous ListNext List
Random wordBack to top

See this list for:

  • Scrabble in English: 7 words
  • French Wiktionary: 1 word
  • Spanish Wiktionary: no word
  • Italian Wiktionary: no word
  • German Wiktionary: no word
  • Portuguese Wiktionary: no word
  • Dutch Wiktionary: no word

Recommended websites



Ortograf Inc.This site uses web cookies, click to learn more. Our privacy policy.
© Ortograf Inc. Website updated on 23 June 2023 (v-2.0.1z). Informations & Contacts.