Word Lists Word Search

List of words containing

Rapid Mode

Click to add a sixth letter

Click to remove the last letter

Click to change word size
All alphabeticalAll by size681011121314151619


There are 16 words containing APYRI

apyrimidicapyrimidinicborapyridinehexapyridylmethapyrilenepapyripapyrianpapyriflavonolpapyriformpapyrinepapyritiouspentapyrimidinepentapyrimidinessalazosulfapyridinesulfapyridinesulphapyridine

17 definitions found

  • apyrimidic — adj. Misspelling of apyrimidinic.
  • apyrimidinic — adj. (Biochemistry) From which pyrimidine bases have been removed.
  • borapyridine — n. (Organic chemistry) A heteroaromatic compound in which a carbon…
  • hexapyridyl — n. (Organic chemistry) Six pyridyl radicals in a compound.
  • methapyrilene — n. A pyridine antihistamine drug with relatively strong sedative effects.
  • papyri — n. Plural of papyrus.
  • papyrian — adj. Alternative form of papyrean.
  • papyriflavonol — n. Any of a group of prenylated flavonol, isolated from the bark…
  • papyriform — adj. (Architecture) Having the form of, or decorated with papyrus flowers.
  • papyrine — n. A kind of vegetable parchment, made by soaking unsized paper… — adj. Of or pertaining to papyrus or paper.
  • papyritious — adj. Resembling paper.
  • pentapyrimidine — n. A sequence of five pyrimidines in a nucleic acid.
  • pentapyrimidines — n. Plural of pentapyrimidine.
  • salazosulfapyridine — n. Synonym of sulfasalazine.
  • sulfapyridine — n. (Pharmacology) A particular antibacterial sulfonamide.
  • sulphapyridine — n. (British spelling, medicine) Alternative spelling of sulfapyridine.
Previous ListNext List
Random wordBack to top

See this list for:

  • Scrabble in English: 3 words
  • French Wiktionary: 10 words
  • Spanish Wiktionary: no word
  • Italian Wiktionary: no word
  • German Wiktionary: 1 word
  • Portuguese Wiktionary: no word
  • Dutch Wiktionary: 1 word

Recommended websites



Ortograf Inc.This site uses web cookies, click to learn more. Our privacy policy.
© Ortograf Inc. Website updated on 23 June 2023 (v-2.0.1z). Informations & Contacts.