Word Lists Word Search

List of words containing

Rapid Mode

Click to add a sixth letter

Click to remove the last letter

Click to change word size
All alphabeticalAll by size89101112131415


There are 23 words containing EGATR

efegatranmegatracksitemegatracksitesmegatragediesmegatragedymegatransposonmegatransposonsmegatrendmegatrendsmegatrialmegatrialsmegatron Megatronmegatrons MegatronsMegatronzmegatropolismegatropolisesnegatronnegatronsomegatronomegatronsspegatrine

24 definitions found

  • efegatran — n. (Pharmacology) An anticoagulant.
  • megatracksite — n. (Paleontology) A site showing geological evidence of very large…
  • megatracksites — n. Plural of megatracksite.
  • megatragedies — n. Plural of megatragedy.
  • megatragedy — n. A huge tragedy.
  • megatransposon — n. A relatively large transposon.
  • megatransposons — n. Plural of megatransposon.
  • megatrend — n. (Informal) A major trend.
  • megatrends — n. Plural of megatrend.
  • megatrial — n. (Medicine) A very large trial (of a pharmaceutical etc), sometimes… — n. A major or large-scale legal trial.
  • megatrials — n. Plural of megatrial.
  • megatron — n. A disc-seal tube, used in lighthouses or submersibles.
  • Megatron — n. (Slang) A fan of American singer-songwriter and television…
  • megatrons — n. Plural of megatron.
  • Megatrons — n. Plural of Megatron.
  • Megatronz — n. Plural of Megatron.
  • megatropolis — n. A very large city.
  • megatropolises — n. Plural of megatropolis.
  • negatron — n. (Physics, obsolete) The electron.
  • negatrons — n. Plural of negatron.
  • omegatron — n. A kind of mass spectrometer using the principles of cyclotron acceleration.
  • omegatrons — n. Plural of omegatron.
  • spegatrine — n. (Medicine, biochemistry) An adrenergic receptor antagonist…
Previous ListNext List
Random wordBack to top

See this list for:

  • Scrabble in English: 2 words
  • French Wiktionary: 10 words
  • Spanish Wiktionary: no word
  • Italian Wiktionary: no word
  • German Wiktionary: 4 words
  • Portuguese Wiktionary: no word
  • Dutch Wiktionary: no word

Recommended websites



Ortograf Inc.This site uses web cookies, click to learn more. Our privacy policy.
© Ortograf Inc. Website updated on 23 June 2023 (v-2.0.1z). Informations & Contacts.