Word Lists Word Search

List of words containing

Rapid Mode

Click to add a sixth letter

Click to remove the last letter

Click to change word size
All alphabeticalAll by size7891011121316


There are 23 words containing ENDAM

badak␣berendamBendameerBendamirbendamustinecommendamcommendamsendamageendamagedendamagementendamagementsendamagesendamagingendamnifiedendamnifiesendamnifyendamoebaendamoebaeendamoebaskendamakendamaslavendamycinpudenda␣muliebriatendamistat

23 definitions found

  • badak␣berendam — n. A popular traditional dessert in Asia; glutinous rice balls…
  • Bendameer — prop.n. Alternative form of Bendamir (“river in Iran”).
  • Bendamir — prop.n. Synonym of Kor (“river in Iran”).
  • bendamustine — n. A particular drug used in chemotherapy.
  • commendam — n. (Religion, obsolete) A vacant benefice commended to a cleric…
  • commendams — n. Plural of commendam.
  • endamage — v. (Archaic) To damage.
  • endamaged — v. Simple past tense and past participle of endamage.
  • endamagement — n. (Obsolete) damage; injury; harm.
  • endamagements — n. Plural of endamagement.
  • endamages — v. Third-person singular simple present indicative form of endamage.
  • endamaging — v. Present participle of endamage.
  • endamnified — v. Simple past tense and past participle of endamnify.
  • endamnifies — v. Third-person singular simple present indicative form of endamnify.
  • endamnify — v. (Transitive) To damnify; to injure.
  • endamoeba — n. Alternative form of endameba.
  • endamoebae — n. Plural of endamoeba.
  • endamoebas — n. Plural of endamoeba.
  • kendama — n. A traditional Japanese toy with an attached ball that can be…
  • kendamas — n. Plural of kendama.
  • lavendamycin — n. (Organic chemistry) A polycyclic heterocycle present in some soil bacteria.
  • pudenda␣muliebria — n. (Anatomy, euphemistic) Vagina; female genitals.
  • tendamistat — n. (Pharmacology) A protein that is a microbial inhibitor of α-amylase.
Previous ListNext List
Random wordBack to top

See this list for:


Recommended websites



Ortograf Inc.This site uses web cookies, click to learn more. Our privacy policy.
© Ortograf Inc. Website updated on 23 June 2023 (v-2.0.1z). Informations & Contacts.