Word Lists Word Search

List of 10-letter words containing

Rapid Mode

Click to add a fourth letter

Click to remove the last letter

Click to change word size
All alphabeticalAll by size345678910111213141516171820


There are 25 ten-letter words containing GIM

antiregimecaporegimecryoregimedigimaticsenregimentFillingimsfire␣regimefungimycingimballinggimbal␣lockgimbletinggimcrackedgimlet-eyedgimlettinggimme␣a␣fivegimmickerygimmickiergimmickilygimmickinggimsilumablongimetrynanoregimeregimentalregimentedungimmicky

29 definitions found

  • antiregime — adj. (Politics) Opposing a regime.
  • caporegime — n. A high-ranking member of a crime family in the Mafia who heads…
  • cryoregime — n. (Ecology) A permanently cold environment.
  • digimatics — n. Plural of digimatic.
  • enregiment — v. (Transitive) To form into a regiment.
  • Fillingims — prop.n. Plural of Fillingim.
  • fire␣regime — n. The general pattern of natural fire occurrence in a particular…
  • fungimycin — n. Perimycin.
  • gimballing — v. Present participle of gimbal.
  • gimbal␣lock — n. The loss of one degree of freedom in the three-dimensional…
  • gimbleting — v. Present participle of gimblet.
  • gimcracked — v. Simple past tense and past participle of gimcrack.
  • gimlet-eyed — adj. Having a squint. — adj. Having eyes which are in constant motion; shifty-eyed. — adj. Having piercing eyes, sharp-sighted.
  • gimletting — v. Present participle of gimlet.
  • gimme␣a␣five — v. (Informal, idiomatic) A request to receive a high five.
  • gimmickery — n. Alternative form of gimmickry.
  • gimmickier — adj. Comparative form of gimmicky: more gimmicky.
  • gimmickily — adv. (Rare) In a gimmicky manner.
  • gimmicking — v. Present participle of gimmick.
  • gimsilumab — n. A human monoclonal antibody under investigation for the treatment…
  • longimetry — n. The measurement of length.
  • nanoregime — n. Nanoscale regime.
  • regimental — adj. (Military) Relating to a regiment. — adj. Overly strict; rigid.
  • regimented — v. Simple past tense and past participle of regiment. — adj. Organised, ordered, formed into regiments.
  • ungimmicky — adj. Not gimmicky.
Previous ListNext List
Random wordBack to top

See this list for:


Recommended websites



Ortograf Inc.This site uses web cookies, click to learn more. Our privacy policy.
© Ortograf Inc. Website updated on 23 June 2023 (v-2.0.1z). Informations & Contacts.