Word Lists Word Search

List of 10-letter words containing

Rapid Mode

Click to add a sixth letter

Click to remove the last letter

Click to change word size
All alphabeticalAll by size8910111213151617


There are 7 ten-letter words containing ISSPE

kisspeptinmisspeakermisspecifymisspelled mis-spelledmisspellermisspender

8 definitions found

  • kisspeptin — n. (Biochemistry) A protein-coupled ligand that plays a role in puberty.
  • misspeaker — n. One who misspeaks.
  • misspecify — v. To specify wrongly.
  • misspelled — adj. Not spelled correctly. — v. Simple past tense and past participle of misspell.
  • mis-spelled — v. Simple past tense and past participle of mis-spell.
  • misspeller — n. One who spells incorrectly.
  • misspender — n. One who misspends.
Previous ListNext List
Random wordBack to top

See this list for:

  • Scrabble in English: 3 words
  • French Wiktionary: no word
  • Spanish Wiktionary: no word
  • Italian Wiktionary: no word
  • German Wiktionary: no word
  • Portuguese Wiktionary: no word
  • Dutch Wiktionary: 1 word

Recommended websites



Ortograf Inc.This site uses web cookies, click to learn more. Our privacy policy.
© Ortograf Inc. Website updated on 23 June 2023 (v-2.0.1z). Informations & Contacts.