Word Lists Word Search

List of 11-letter words containing

Rapid Mode

Click to add a sixth letter

Click to remove the last letter

Click to change word size
All alphabeticalAll by size89101112131516


There are 10 eleven-letter words containing INAST

dazoquinastfeminastiesfinasteridegravinasticmapinastinenyctinasticspinasterolulinastatinurinastatinVergina␣star

10 definitions found

  • dazoquinast — n. An antiasthmatic drug.
  • feminasties — n. Plural of feminasty.
  • finasteride — n. (Pharmacology) A nitrogenous steroid derivative C23H36N2O2
  • gravinastic — adj. Of or relating to gravinasty.
  • mapinastine — n. A histamine 1 receptor antagonist.
  • nyctinastic — adj. Relating to nyctinasty, the movement of leaves or petals…
  • spinasterol — n. (Organic chemistry) A phytosterol found in a variety of plant…
  • ulinastatin — n. A glycoprotein, either derived from urine or produced synthetically…
  • urinastatin — n. Alternative form of ulinastatin.
  • Vergina␣star — n. Synonym of Vergina sun.
Previous ListNext List
Random wordBack to top

See this list for:


Recommended websites



Ortograf Inc.This site uses web cookies, click to learn more. Our privacy policy.
© Ortograf Inc. Website updated on 23 June 2023 (v-2.0.1z). Informations & Contacts.