Word Lists Word Search

List of 15-letter words containing

Rapid Mode

Click to add a sixth letter

Click to remove the last letter

Click to change word size
All alphabeticalAll by size56789101112131415161718192021


There are 15 fifteen-letter words containing INITY

affinity␣reagentantimasculinityaxiom␣of␣infinityhyperalkalinityhyperfemininityhypomasculinityinfinity␣scarvesinfinity␣symbolsmetalloaffinitypoint␣at␣infinitysuperalkalinitytoxic␣femininitytransfemininityTrinity␣Bay␣Northvirginity␣pledge

17 definitions found

  • affinity␣reagent — n. (Biochemistry) An antibody, peptide, nucleic acid, or other…
  • antimasculinity — n. Beliefs and behaviours that oppose or shun masculinity.
  • axiom␣of␣infinity — n. (Set theory) One of the axioms in axiomatic set theory that…
  • hyperalkalinity — n. The property of being hyperalkaline.
  • hyperfemininity — n. The condition of being extremely feminine; excessive femininity.
  • hypomasculinity — n. The quality or exhibition of unmasculine behavior or traits…
  • infinity␣scarves — n. Plural of infinity scarf.
  • infinity␣symbols — n. Plural of infinity symbol.
  • metalloaffinity — n. The affinity for a metal atom, typically one in a metalloprotein.
  • point␣at␣infinity — n. An asymptotic point in 3-dimensional space, viewed from some… — n. (Geometry, Euclidean projective geometry) Any point added to… — n. (Geometry, hyperbolic geometry) An ideal point.
  • superalkalinity — n. The property of being superalkaline.
  • toxic␣femininity — n. (Gender theory) Those aspects of traditional femininity perceived…
  • transfemininity — n. The quality of being transfeminine.
  • Trinity␣Bay␣North — prop.n. A town in Newfoundland, Newfoundland and Labrador, Canada.
  • virginity␣pledge — n. A pledge, made by a young adult, to refrain from sexual intercourse…
Previous ListNext List
Random wordBack to top

See this list for:

  • Scrabble in English: 1 word
  • French Wiktionary: no word
  • Spanish Wiktionary: no word
  • Italian Wiktionary: no word
  • German Wiktionary: no word
  • Portuguese Wiktionary: no word
  • Dutch Wiktionary: no word

Recommended websites



Ortograf Inc.This site uses web cookies, click to learn more. Our privacy policy.
© Ortograf Inc. Website updated on 23 June 2023 (v-2.0.1z). Informations & Contacts.