Word Lists Word Search

List of 11-letter words containing

Rapid Mode

Click to add a seventh letter

Click to remove the last letter

Click to change word size
All alphabeticalAll by size910111213


There are 4 eleven-letter words containing INASTI

feminastiesgravinasticmapinastinenyctinastic

4 definitions found

  • feminasties — n. Plural of feminasty.
  • gravinastic — adj. Of or relating to gravinasty.
  • mapinastine — n. A histamine 1 receptor antagonist.
  • nyctinastic — adj. Relating to nyctinasty, the movement of leaves or petals…
Previous ListNext List
Random wordBack to top

See this list for:

  • Scrabble in English: 1 word
  • French Wiktionary: 1 word
  • Spanish Wiktionary: 1 word
  • Italian Wiktionary: 52 words
  • German Wiktionary: 1 word
  • Portuguese Wiktionary: no word
  • Dutch Wiktionary: no word

Recommended websites



Ortograf Inc.This site uses web cookies, click to learn more. Our privacy policy.
© Ortograf Inc. Website updated on 23 June 2023 (v-2.0.1z). Informations & Contacts.