Word Lists Word Search

List of words containing

Rapid Mode

Click to add a seventh letter

Click to remove the last letter

Click to change word size
All alphabeticalAll by size910111213141516


There are 24 words containing PARASP

paraspasticparaspeciesparaspecificparaspecificityparaspeckleparaspecklesparaspermparasphenoidparasphenoidalparasphenoidsparaspinalparaspinallyparaspinousparasplenialparasporalparasporal␣bodiesparasporal␣bodyparasporinparasporinsparasport para-sportparasports para-sportsparaspurrite

25 definitions found

  • paraspastic — adj. Relating to spastic paraplegia.
  • paraspecies — n. A species that gave rise to daughter species without itself becoming extinct.
  • paraspecific — adj. (Medicine) Serving as a remedy against conditions beyond…
  • paraspecificity — n. The quality of being paraspecific.
  • paraspeckle — n. (Cytology) An irregularly shaped compartment of the cell, found…
  • paraspeckles — n. Plural of paraspeckle.
  • parasperm — n. (Zoology) In species that exhibit sperm heteromorphism, infertile sperm.
  • parasphenoid — n. (Anatomy) A bone situated immediately beneath the sphenoid… — adj. Lying under or alongside the sphenoid.
  • parasphenoidal — adj. (Anatomy) Relating to the parasphenoid (bone).
  • parasphenoids — n. Plural of parasphenoid.
  • paraspinal — adj. (Anatomy) adjacent to the spine.
  • paraspinally — adv. In a paraspinal manner.
  • paraspinous — adj. Synonym of paraspinal.
  • parasplenial — adj. (Anatomy) Across or beyond the splenium.
  • parasporal — adj. (Biochemistry) Describing a crystalline protein that forms…
  • parasporal␣bodies — n. Plural of parasporal body.
  • parasporal␣body — n. (Biology) A crystalline structure, within the core of an endospore…
  • parasporin — n. Any of a group of proteins with anticancer activity, derived…
  • parasporins — n. Plural of parasporin.
  • parasport — n. (Countable, sports) disabled sport.
  • para-sport — n. Alternative form of parasport.
  • parasports — n. Plural of parasport.
  • para-sports — n. Plural of para-sport.
  • paraspurrite — n. (Mineralogy) A polysynthetically twinned spurrite.
Previous ListNext List
Random wordBack to top

See this list for:

  • Scrabble in English: 2 words
  • French Wiktionary: 6 words
  • Spanish Wiktionary: no word
  • Italian Wiktionary: no word
  • German Wiktionary: 8 words
  • Portuguese Wiktionary: no word
  • Dutch Wiktionary: 1 word

Recommended websites



Ortograf Inc.This site uses web cookies, click to learn more. Our privacy policy.
© Ortograf Inc. Website updated on 23 June 2023 (v-2.0.1z). Informations & Contacts.