Word Lists Word Search

List of 7-letter words containing

Rapid Mode

Click to add a fourth letter

Click to remove the last letter

Click to change word size
All alphabeticalAll by size34567891011121314151617181921


There are 18 seven-letter words containing YPS

calypso Calypsocrypsiscypselagypseysgypsidsgypsiedgypsies Gypsiesgypsifygypstergypsumsgypsyfykrypsisstypsistrypsinypsigonypsilon

25 definitions found

  • calypso — n. A style of Caribbean music that originated in Trinidad and… — v. (Intransitive) To perform calypso. — n. A bulbous bog orchid of the genus Calypso, Calypso bulbosa.
  • Calypso — prop.n. (Greek mythology) A sea nymph who entertained Odysseus… — prop.n. (Astronomy) The eighth moon of Saturn. — prop.n. (Astronomy) 53 Kalypso, a main belt asteroid; not to be…
  • crypsis — n. (Biology) The ability of an organism to avoid observation.
  • cypsela — n. (Botany) An achene formed from an inferior bicarpellary ovary…
  • gypseys — n. Plural of gypsey.
  • gypsids — n. Plural of gypsid.
  • gypsied — v. Simple past tense and past participle of gypsy.
  • gypsies — n. Plural of gypsy. — n. Plural of gypsie.
  • Gypsies — n. Plural of Gypsy.
  • gypsify — v. (Geology) To diagenetically alter to gypsum. — v. (Sometimes offensive) to become or make gypsy.
  • gypster — n. A trickster or swindler.
  • gypsums — n. Plural of gypsum.
  • gypsyfy — v. Alternative form of gypsify (“to make or become gypsy”).
  • krypsis — n. (Theology) The doctrine that Christ, during His state of humiliation…
  • stypsis — n. Astringency. — n. The use or the action of a styptic.
  • trypsin — n. (Biochemistry) A digestive enzyme that cleaves peptide bonds…
  • ypsigon — n. The amorphous post-larval stage of the crustacean Hansenocaris…
  • ypsilon — n. Alternative form of upsilon.
Previous ListNext List
Random wordBack to top

See this list for:

  • Scrabble in English: 11 words
  • French Wiktionary: 18 words
  • Spanish Wiktionary: no word
  • Italian Wiktionary: 1 word
  • German Wiktionary: 2 words
  • Portuguese Wiktionary: no word
  • Dutch Wiktionary: 2 words

Recommended websites



Ortograf Inc.This site uses web cookies, click to learn more. Our privacy policy.
© Ortograf Inc. Website updated on 23 June 2023 (v-2.0.1z). Informations & Contacts.