Word Lists Word Search

List of words containing

Rapid Mode

Click to add a sixth letter

Click to remove the last letter

Click to change word size
All alphabeticalAll by size89101920


There are 12 words containing YFRAM

keyframe key␣frame  ——  keyframedkeyframerkeyframes key␣framesplayframe  ——  keyframerskeyframingplayframes  ——  regulatory␣framework  ——  regulatory␣frameworks

14 definitions found

  • keyframe — n. A single frame in an animation sequence drawn by an artist… — n. (Computer graphics) A complete video frame, used as a reference… — v. To animate by interpolation between successive keyframes.
  • key␣frame — n. Alternative form of keyframe.
  • keyframed — v. Simple past tense and past participle of keyframe.
  • keyframer — n. A software tool that automates keyframing.
  • keyframes — n. Plural of keyframe.
  • key␣frames — n. Plural of key frame.
  • playframe — n. A children’s climbing frame incorporating other elements, such…
  • keyframers — n. Plural of keyframer.
  • keyframing — v. Present participle of keyframe.
  • playframes — n. Plural of playframe.
  • regulatory␣framework — n. A set of regulations that is valid in a given industry.
  • regulatory␣frameworks — n. Plural of regulatory framework.
Previous ListNext List
Random wordBack to top

See this list for:

  • Scrabble in English: 2 words
  • French Wiktionary: no word
  • Spanish Wiktionary: no word
  • Italian Wiktionary: no word
  • German Wiktionary: no word
  • Portuguese Wiktionary: no word
  • Dutch Wiktionary: no word

Recommended websites



Ortograf Inc.This site uses web cookies, click to learn more. Our privacy policy.
© Ortograf Inc. Website updated on 23 June 2023 (v-2.0.1z). Informations & Contacts.